PDB entry 5vf9

View 5vf9 on RCSB PDB site
Description: Native human manganese superoxide dismutase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2017-04-07, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (1-198)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5vf9a1, d5vf9a2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (1-198)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5vf9b1, d5vf9b2
  • Heterogens: MN, PO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vf9A (A:)
    mkhslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqia
    lqpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvq
    gsgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylka
    iwnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vf9B (B:)
    mkhslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqia
    lqpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvq
    gsgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylka
    iwnvinwenvterymackk