PDB entry 5vf5

View 5vf5 on RCSB PDB site
Description: Crystal structure of the vicilin from Solanum melongena, re-refinement
Class: plant protein
Keywords: 7s vicilin sm80.1 plant protein sequence assignment re-refinement, plant protein
Deposited on 2017-04-06, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SM80.1 Vicilin
    Species: Solanum melongena [TaxId:4111]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VF5
    Domains in SCOPe 2.07: d5vf5a1, d5vf5a2
  • Heterogens: NA, ACT, CU, PEG, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vf5A (A:)
    pgreqqeenvpylfksqrfqsrfrashgdfrilpkftqrsqllrgiekfrvsvielepqs
    fmlphhcdgeaifvvvrgqgtisiaeqdeknsfnlergdvlrlhggstihllnrdnnekf
    fvyvlaksvnapgqvqeyfsaggenpesfyrafssdilesafntqrdrierlfrqqkqga
    iikaseeqiraisehasrstqqtrgrtqgpfnlmkerpqfgsrfgqfieasperfeqlrd
    ldaavafmninqggmvlpyynsrstrvvmvvegnarfemacphlgrqgrgqggeqeqeqe
    egevhyqkvrgnlnvgdvlvipaghpitfiatggsnfrvvgfginamfnrknflagreni
    wrnidreakelsfnmpgreveeifqkqdqsyfvagpehrqqqpgergeegrkgqdqylss
    ildfvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vf5A (A:)
    qqeenvpylfksqrfqsrfrashgdfrilpkftqrsqllrgiekfrvsvielepqsfmlp
    hhcdgeaifvvvrgqgtisiaeqdeknsfnlergdvlrlhggstihllnrdnnekffvyv
    laksvnapgqvqeyfsaggenpesfyrafssdilesafntqrdrierlfrqqkqgaiika
    seeqiraisehasrtqgpfnlmkerpqfgsrfgqfieasperfeqlrdldaavafmninq
    ggmvlpyynsrstrvvmvvegnarfemacphlggevhyqkvrgnlnvgdvlvipaghpit
    fiatggsnfrvvgfginamfnrknflagreniwrnidreakelsfnmpgreveeifqkqd
    qsyfvagpeh