PDB entry 5veq

View 5veq on RCSB PDB site
Description: mouse kynurenine aminotransferase III, re-refinement of the pdb structure 3e2y
Class: transferase
Keywords: aminotransferase III, mouse, re-refinement, transferase
Deposited on 2017-04-05, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kynurenine--oxoglutarate transaminase 3
    Species: Mus musculus [TaxId:10090]
    Gene: Kyat3, Ccbl2, Kat3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71RI9 (1-410)
      • expression tag (0)
    Domains in SCOPe 2.07: d5veqa1, d5veqa2
  • Chain 'B':
    Compound: Kynurenine--oxoglutarate transaminase 3
    Species: Mus musculus [TaxId:10090]
    Gene: Kyat3, Ccbl2, Kat3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71RI9 (1-410)
      • expression tag (0)
    Domains in SCOPe 2.07: d5veqb1, d5veqb2
  • Heterogens: PMP, EPE, PGE, GOL, CA, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5veqA (A:)
    anakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytr
    gfghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfy
    dcyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnp
    lgkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsag
    ktfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyf
    nslpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvk
    wmtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veqA (A:)
    anakriegldsnvwveftdpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrgfgh
    palvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfydcye
    pmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnplgkv
    ytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagktfs
    vtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfnslp
    kelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvkwmtk
    hkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5veqB (B:)
    anakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytr
    gfghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfy
    dcyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnp
    lgkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsag
    ktfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyf
    nslpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvk
    wmtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veqB (B:)
    anakriegldsnvwvefdpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrgfghp
    alvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfydcyep
    mvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnplgkvy
    trqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagktfsv
    tgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfnslpk
    elevkrdrmvrllnsvglkpivpdggyfiiadvsslepydykfvkwmtkhkkltaipvsa
    fcdskskphfeklvrfcfikkdstldaaeeifrawn