PDB entry 5vep

View 5vep on RCSB PDB site
Description: mouse kynurenine aminotransferase III, re-refinement of the pdb structure 3e2f
Class: transferase
Keywords: aminotransferase III, mouse, re-refinement, transferase
Deposited on 2017-04-05, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kynurenine--oxoglutarate transaminase 3
    Species: Mus musculus [TaxId:10090]
    Gene: Kyat3, Ccbl2, Kat3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vepa_
  • Chain 'B':
    Compound: Kynurenine--oxoglutarate transaminase 3
    Species: Mus musculus [TaxId:10090]
    Gene: Kyat3, Ccbl2, Kat3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vepb_
  • Heterogens: EPE, PEG, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vepA (A:)
    nakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrg
    fghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfyd
    cyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnpl
    gkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagk
    tfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfn
    slpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvkw
    mtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vepB (B:)
    nakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrg
    fghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfyd
    cyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnpl
    gkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagk
    tfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfn
    slpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvkw
    mtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn