PDB entry 5vej

View 5vej on RCSB PDB site
Description: High resolution crystal structure of a fluoride-inhibited organo-phosphate-degrading metallohydrolase
Class: hydrolase
Keywords: metallohydrolase, fluoride, inhibited, organo-phosphate-degrading, HYDROLASE
Deposited on 2017-04-04, released 2017-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Rhizobium radiobacter [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veja_
  • Heterogens: ACT, CO, F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vejA (A:)
    gdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrharsa
    gvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflre
    iqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegnasalalfg
    trswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrvi
    pflrekgvppetlagvtvanparflspt