PDB entry 5veh

View 5veh on RCSB PDB site
Description: Re-refinement OF THE PDB STRUCTURE 1yiz of Aedes aegypti kynurenine aminotransferase
Class: transferase
Keywords: Re-refinement, kynurenine aminotransferase, mosquito, TRANSFERASE
Deposited on 2017-04-04, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kynurenine aminotransferase
    Species: Aedes aegypti [TaxId:7159]
    Gene: KAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veha_
  • Chain 'B':
    Compound: Kynurenine aminotransferase
    Species: Aedes aegypti [TaxId:7159]
    Gene: KAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vehb_
  • Heterogens: BR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vehA (A:)
    msstsnetmhnkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnala
    aaanspdplanqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqg
    hvdegdeviiiepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfn
    ektkmiiintphnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictl
    pgmwertitigsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgf
    etelkrlkspecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvd
    ltqetdarkdyrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaae
    ilrkwkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vehA (A:)
    kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan
    qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii
    epffdcyepmvkaaggiprfiplkpnissadwvldnnelealfnektkmiiintphnplg
    kvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitigsagkt
    fsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspecyfns
    isgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkdyrftkw
    mtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vehB (B:)
    msstsnetmhnkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnala
    aaanspdplanqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqg
    hvdegdeviiiepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfn
    ektkmiiintphnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictl
    pgmwertitigsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgf
    etelkrlkspecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvd
    ltqetdarkdyrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaae
    ilrkwkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vehB (B:)
    kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan
    qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii
    epffdcyepmvkaaggiprfiplkpnissadwvldnnelealfnektkmiiintphnplg
    kvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitigsagkt
    fsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspecyfns
    isgelmakrdymasflaevgmnptvpqggyfmvadwsslarkdyrftkwmtksvglqgip
    psafysepnkhlgedfvrycffkkdenlqkaaeilrkwk