PDB entry 5vea

View 5vea on RCSB PDB site
Description: HIV Protease (PR) with TL-3 in active site and 4-methylbenzene-1,2-diamine in exosite
Class: hydrolase
Keywords: protease, allostery, fragment binding, exosite, HYDROLASE
Deposited on 2017-04-04, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72863 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.07: d5veaa_
  • Heterogens: 3TL, 9AY, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5veaA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf