PDB entry 5vdb

View 5vdb on RCSB PDB site
Description: Crystal structure of a GNAT superfamily acetyltransferase PA4794 in complex with bisubstrate analog 3
Class: transferase/transferase inhibitor
Keywords: GNAT, acetyltransferase, bisubstrate inhibitor, Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, TRANSFERASE, transferase-transferase inhibitor complex
Deposited on 2017-04-01, released 2017-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyltransferase PA4794
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: PA4794
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5vdba_
  • Heterogens: SO4, 93M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5vdbA (A:)
ghmqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhd
gqvlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscf
nanaaglllytqlgyqpraiaerhdpdgrrvaliqmdkple

    Sequence, based on observed residues (ATOM records): (download) 
    >5vdbA (A:)
mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq
vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna
naaglllytqlgyqpraiaerhdpdgrrvaliqmdkple