PDB entry 5vd5

View 5vd5 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF HUMAN WEE1 KINASE DOMAIN IN COMPLEX WITH RAC-IV-050, a MK1775 analougue
Class: transferase/transferase inhibitor
Keywords: KINASE DOMAIN, CELL CYCLE, WEE1, TRANSFERASE, INHIBITOR, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-04-01, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Wee1-like protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: WEE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vd5a_
  • Heterogens: 99M, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vd5A (A:)
    gagsmksryttefhelekigsgefgsvfkcvkrldgciyaikrskkplagsvdeqnalre
    vyahavlgqhshvvryfsawaeddhmliqneycnggsladaisenyrimsyfkeaelkdl
    llqvgrglryihsmslvhmdikpsnifisrtsipnaaseegdeddwasnkvmfkigdlgh
    vtrisspqveegdsrflanevlqenythlpkadifalaltvvcaagaeplprngdqwhei
    rqgrlpripqvlsqeftellkvmihpdperrpsamalvkhsvllsasrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vd5A (A:)
    sryttefhelekigsgefgsvfkcvkrldgciyaikrskkplagsvdeqnalrevyahav
    lgqhshvvryfsawaeddhmliqneycnggsladaisenyrimsyfkeaelkdlllqvgr
    glryihsmslvhmdikpsnifisrkvmfkigdlghvtrisspqveegdsrflanevlqen
    ythlpkadifalaltvvcaagaeplprngdqwheirqgrlpripqvlsqeftellkvmih
    pdperrpsamalvkhsvlls