PDB entry 5vcq

View 5vcq on RCSB PDB site
Description: A Hyrdrogen Producing Hybrid Streptavidin-Diiron Catalyst
Class: Biotin Binding Protein
Keywords: Protein-organometallic catalyst, hydrogenase, hybrid protein, 4Fe-4S clusters, Biotin Binding Protein
Deposited on 2017-03-31, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vcqa_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vcqb_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vcqc_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vcqd_
  • Heterogens: BN7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vcqA (A:)
    mrkivvaaiavslttvsitasasadpskdskaqvsaaeagitgtwynqlgstfivtagad
    galtgtyesavgnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqy
    vggaearintqwlltsgtteanawkstlvghdtftkvkpsaasidaakkagvnngnplda
    vqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vcqA (A:)
    eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
    gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vcqB (B:)
    mrkivvaaiavslttvsitasasadpskdskaqvsaaeagitgtwynqlgstfivtagad
    galtgtyesavgnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqy
    vggaearintqwlltsgtteanawkstlvghdtftkvkpsaasidaakkagvnngnplda
    vqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vcqB (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vcqC (C:)
    mrkivvaaiavslttvsitasasadpskdskaqvsaaeagitgtwynqlgstfivtagad
    galtgtyesavgnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqy
    vggaearintqwlltsgtteanawkstlvghdtftkvkpsaasidaakkagvnngnplda
    vqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vcqC (C:)
    eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
    gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    k
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vcqD (D:)
    mrkivvaaiavslttvsitasasadpskdskaqvsaaeagitgtwynqlgstfivtagad
    galtgtyesavgnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqy
    vggaearintqwlltsgtteanawkstlvghdtftkvkpsaasidaakkagvnngnplda
    vqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vcqD (D:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp