PDB entry 5vc2

View 5vc2 on RCSB PDB site
Description: Crystal structure of a serine hydroxymethyltransferase from Helicobacter pylori
Class: transferase
Keywords: structural genomics, NIAID, digestive disease, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2017-03-30, released 2017-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Helicobacter pylori (strain G27) [TaxId:563041]
    Gene: glyA, HPG27_169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vc2a_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Helicobacter pylori (strain G27) [TaxId:563041]
    Gene: glyA, HPG27_169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vc2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vc2A (A:)
    mahhhhhhmayfleqtdseifelifeeykrqnehlemiasenytfpsvmeamgsiltnky
    aegypnkryyggcevvdkieslaierakklfncqfanvqahsgsqannavyhallkpydk
    ilgmdlscgghlthgakvsltgkhyqsfsygvnldgyidyeealkiaqsvkpeiivcgfs
    aypreidfkkfreiadevgalllgdiahvaglvvtnehahpfphchvvsstthktlrgpr
    ggiiltndeeiaakidkaifpgtqggplmhviaakavgfkenlkpefkayaklvksnmqv
    lakalkeknhklvsggtsnhlllmdfldkpysgkdadialgnagitvnkntipgetrspf
    vtsgirigsaalsargmgakefeiignkisdilndinnvslqlhvkeelkamanqfpvyq
    qpif
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vc2A (A:)
    yfleqtdseifelifeeykrqnehlemiasenytfpsvmeamgsiltnkyavvdkiesla
    ierakklfncqfanvqahsgsqannavyhallkpydkilgmdlscvsltgkhyqsfsygv
    nldgyidyeealkiaqsvkpeiivcgfsaypreidfkkfreiadevgalllgdiahvagl
    vvtnehahpfphchvvsstthktlrgprggiiltndeeiaakidkaigplmhviaakavg
    fkenlkpefkayaklvksnmqvlakalkeknhklvsggtsnhlllmdfldkpysgkdadi
    algnagitvnkntipgetrspfvtsgirigsaalsargmgakefeiignkisdilndinn
    vslqlhvkeelkamanqfpvyqqpif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vc2B (B:)
    mahhhhhhmayfleqtdseifelifeeykrqnehlemiasenytfpsvmeamgsiltnky
    aegypnkryyggcevvdkieslaierakklfncqfanvqahsgsqannavyhallkpydk
    ilgmdlscgghlthgakvsltgkhyqsfsygvnldgyidyeealkiaqsvkpeiivcgfs
    aypreidfkkfreiadevgalllgdiahvaglvvtnehahpfphchvvsstthktlrgpr
    ggiiltndeeiaakidkaifpgtqggplmhviaakavgfkenlkpefkayaklvksnmqv
    lakalkeknhklvsggtsnhlllmdfldkpysgkdadialgnagitvnkntipgetrspf
    vtsgirigsaalsargmgakefeiignkisdilndinnvslqlhvkeelkamanqfpvyq
    qpif
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vc2B (B:)
    ayfleqtdseifelifeeykrqnehlemiasenytfpsvmeamgsiltnkyavdkiesla
    ierakklfncqfanvqahsgsqannavyhallkpydkilgmdgkhyqsfsygvnldgyid
    yeealkiaqsvkpeiivcgfsaypreidfkkfreiadevgalllgdiahvaglvvtneha
    hpfphchvvsstthktlrgprggiiltndeeiaakidkaifgplmhviaakavgfkenlk
    pefkayaklvksnmqvlakalkeknhklvsggtsnhlllmdfldkpysgkdadialgnag
    itvnkntipgetrspfvtsgirigsaalsargmgakefeiignkisdilndinnvslqlh
    vkeelkamanqfpvyqqpif