PDB entry 5vbr

View 5vbr on RCSB PDB site
Description: CRYSTAL STRUCTURE OF THE FIRST BROMODOMAIN OF HUMAN BRDT IN COMPLEX WITH Volasertib
Class: transcription/inhibitor
Keywords: bromodomain, cap, hunk1, mcap, protein binding-inhibitor complex, mitotic chromosome associated protein, inhibitor, transcription-inhibitor complex
Deposited on 2017-03-30, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain testis-specific protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRDT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58F21 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5vbra1, d5vbra2
  • Chain 'B':
    Compound: Bromodomain testis-specific protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRDT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58F21 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d5vbrb1, d5vbrb2
  • Heterogens: IBI, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vbrA (A:)
    gaastnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrle
    nkyyakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbrA (A:)
    gaastnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrle
    nkyyakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vbrB (B:)
    gaastnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrle
    nkyyakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbrB (B:)
    stnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenky
    yakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqe