PDB entry 5vb8

View 5vb8 on RCSB PDB site
Description: Crystal structure of the NavAb voltage-gated sodium channel in an open state
Class: transport protein
Keywords: Voltage-gated sodium channel, TRANSPORT PROTEIN
Deposited on 2017-03-28, released 2017-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ion transport protein
    Species: Arcobacter butzleri [TaxId:28197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-End)
      • expression tag (16-17)
      • conflict (234)
    Domains in SCOPe 2.08: d5vb8a1, d5vb8a2
  • Heterogens: NA, PX4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vb8A (A:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfifvvtfvminlvvaicvdama
    ilnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vb8A (A:)
    shmylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitifti
    eiilriyvhrisffkdpwslfdffvvaislveilrvlrvlrlfrlvtavpqmrkivsali
    svipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsmgiv
    rplmevypyawvffipfifvvtfvminlvvaicvd