PDB entry 5vas

View 5vas on RCSB PDB site
Description: Pekin duck egg lysozyme isoform III (DEL-III), orthorhombic form
Class: hydrolase
Keywords: duck lysozyme, glycosyl hydrolase, N-acetylmuramidase, HYDROLASE
Deposited on 2017-03-27, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3J0P1 (0-128)
      • conflict (78)
      • conflict (99)
    Domains in SCOPe 2.07: d5vasa_
  • Chain 'B':
    Compound: lysozyme
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3J0P1 (0-128)
      • conflict (78)
      • conflict (99)
    Domains in SCOPe 2.07: d5vasb_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vasA (A:)
    kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
    rwwcddgktprsknacgircsvllrsditeavrcakrivrdgngmnawvawrnrcrgtdv
    skwirgcrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vasB (B:)
    kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
    rwwcddgktprsknacgircsvllrsditeavrcakrivrdgngmnawvawrnrcrgtdv
    skwirgcrl