PDB entry 5var

View 5var on RCSB PDB site
Description: Crystal structure of KDM4A tandem TUDOR domain in complex with a tri-methyl lysine competitive inhibitor
Class: oxidoreductase
Keywords: KDM4A tandem TUDOR domain, OXIDOREDUCTASE
Deposited on 2017-03-27, released 2018-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5vara1, d5vara2
  • Heterogens: 92Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5varA (A:)
    gshmqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdcl
    qfgppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5varA (A:)
    qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfgp
    paegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvy