PDB entry 5van

View 5van on RCSB PDB site
Description: Crystal Structure of Beta-Klotho
Class: signaling protein
Keywords: (beta/alpha)8 Receptor for Endocrine FGF, SIGNALING PROTEIN
Deposited on 2017-03-27, released 2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-klotho
    Species: Homo sapiens [TaxId:9606]
    Gene: KLB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86Z14
      • engineered mutation (278)
      • engineered mutation (581)
  • Chain 'B':
    Compound: Nb914
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VAN
    Domains in SCOPe 2.07: d5vanb_
  • Heterogens: NAG, MAN, BGC, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vanB (B:)
    qvqlvesggglvqaggslrlscaasqrtfspyvggwfrqapgkerefvaaiswsggtkly
    adsvkgrftisrdnakntvylqmntlkredtavyycaarrinevlttapdydfwgqgtqv
    tvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vanB (B:)
    vqlvesggglvqaggslrlscaasqrtfspyvggwfrqapgkerefvaaiswsggtklya
    dsvkgrftisrdnakntvylqmntlkredtavyycaarrinevlttapdydfwgqgtqvt
    vs