PDB entry 5v9j

View 5v9j on RCSB PDB site
Description: Crystal structure of catalytic domain of GLP with MS0105
Class: transferase
Keywords: EHMT1, methyltransferase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2017-03-23, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.7400000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase EHMT1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT1, EUHMTASE1, GLP, KIAA1876, KMT1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5v9ja_
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase EHMT1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT1, EUHMTASE1, GLP, KIAA1876, KMT1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5v9jb_
  • Heterogens: SAM, 90P, ZN, CL, UNX, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v9jA (A:)
    gsnsqvwsalqmskalqdsapdrpspverivsrdiargyeripipcvnavdsepcpsnyk
    yvsqncvtspmnidrnithlqycvciddcsssncmcgqlsmrcwydkdgrllpefnmaep
    plifecnhacscwrncrnrvvqnglrarlqlyrtrdmgwgvrslqdippgtfvceyvgel
    isdseadvreedsylfdldnkdgevycidarfygnvsrfinhhcepnlvpvrvfmahqdl
    rfpriaffstrlieageqlgfdygerfwdikgklfscrcgspkcrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v9jA (A:)
    verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
    ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
    arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldgevycid
    arfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerfwd
    ikgklfscrcgspkcrhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v9jB (B:)
    gsnsqvwsalqmskalqdsapdrpspverivsrdiargyeripipcvnavdsepcpsnyk
    yvsqncvtspmnidrnithlqycvciddcsssncmcgqlsmrcwydkdgrllpefnmaep
    plifecnhacscwrncrnrvvqnglrarlqlyrtrdmgwgvrslqdippgtfvceyvgel
    isdseadvreedsylfdldnkdgevycidarfygnvsrfinhhcepnlvpvrvfmahqdl
    rfpriaffstrlieageqlgfdygerfwdikgklfscrcgspkcrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v9jB (B:)
    verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
    ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
    arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldnkgevyc
    idarfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerf
    wdikgklfscrcgspkcrhs