PDB entry 5v9i

View 5v9i on RCSB PDB site
Description: Crystal structure of catalytic domain of G9a with MS0105
Class: transferase
Keywords: EHMT2, BAT8, methyltransferase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2017-03-23, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase EHMT2
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT2, BAT8, C6orf30, G9A, KMT1C, NG36
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v9ia_
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase EHMT2
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT2, BAT8, C6orf30, G9A, KMT1C, NG36
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v9ib_
  • Chain 'C':
    Compound: Histone-lysine N-methyltransferase EHMT2
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT2, BAT8, C6orf30, G9A, KMT1C, NG36
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v9ic_
  • Chain 'D':
    Compound: Histone-lysine N-methyltransferase EHMT2
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT2, BAT8, C6orf30, G9A, KMT1C, NG36
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v9id_
  • Heterogens: ZN, SAM, 90P, GOL, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v9iA (A:)
    gsnrairtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnith
    lqhctcvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknr
    vvqsgikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdld
    nkdgevycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeel
    gfdygdrfwdikskyftcqcgsekckhsaeaialeqsrlarld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v9iA (A:)
    irtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhct
    cvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsg
    ikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldevyci
    daryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfw
    dikskyftcqcgsekckhsaeaiale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v9iB (B:)
    gsnrairtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnith
    lqhctcvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknr
    vvqsgikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdld
    nkdgevycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeel
    gfdygdrfwdikskyftcqcgsekckhsaeaialeqsrlarld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v9iB (B:)
    tekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcv
    ddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgik
    vrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldevycida
    ryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwdi
    kskyftcqcgsekckhsaeaialeqsrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5v9iC (C:)
    gsnrairtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnith
    lqhctcvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknr
    vvqsgikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdld
    nkdgevycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeel
    gfdygdrfwdikskyftcqcgsekckhsaeaialeqsrlarld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v9iC (C:)
    irtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhct
    cvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsg
    ikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldevyci
    daryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfw
    dikskyftcqcgsekckhsaeaial
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5v9iD (D:)
    gsnrairtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnith
    lqhctcvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknr
    vvqsgikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdld
    nkdgevycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeel
    gfdygdrfwdikskyftcqcgsekckhsaeaialeqsrlarld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v9iD (D:)
    tekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcv
    ddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgik
    vrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldevycida
    ryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwdi
    kskyftcqcgsekckhsaeaialeq