PDB entry 5v80

View 5v80 on RCSB PDB site
Description: PIM1 kinase in complex with Cpd1 (1-methyl-4-(3-(6-(piperazin-1-yl)pyridin-2-yl)-1H-pyrazolo[3,4-c]pyridin-5-yl)piperazin-2-one)
Class: transferase/inhibitor
Keywords: PIM1, SBDD, TRANSFERASE-INHIBITOR complex
Deposited on 2017-03-21, released 2018-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5v80a_
  • Heterogens: PO4, 971, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v80A (A:)
    mkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvp
    mevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsf
    fwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvy
    sppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhli
    rwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v80A (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh