PDB entry 5v7k

View 5v7k on RCSB PDB site
Description: PCNA mutant D41A/D42A Protein Defective in Gene Silencing
Class: DNA binding protein
Keywords: caf-1, DNA binding protein
Deposited on 2017-03-20, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: POL30, YBR088C, YBR0811
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15873 (7-End)
      • engineered mutation (47-48)
    Domains in SCOPe 2.07: d5v7ka1, d5v7ka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v7kA (A:)
    mhhhhhhmleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavaasrvllvsleig
    veafqeyrcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriae
    yslklmdidadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadg
    digsgsviikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlssea
    palfqfdlksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v7kA (A:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavaasrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfn