PDB entry 5v7i

View 5v7i on RCSB PDB site
Description: Crystal structure of homo sapiens serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), in complex with glycine, PLP and folate-competitive pyrazolopyran inhibitor: 6-amino-4-isopropyl-3-methyl-4-(3-(pyrrolidin-1-yl)-5-(trifluoromethyl)phenyl)-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
Class: Transferase/Transferase Inhibitor
Keywords: SHMT2, serine catabolism, antifolate, Transferase-Transferase Inhibitor complex
Deposited on 2017-03-20, released 2017-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine hydroxymethyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SHMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5v7ia_
  • Chain 'B':
    Compound: Serine hydroxymethyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SHMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5v7ib_
  • Heterogens: 8Z1, GOL, PEG, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v7iA (A:)
    snaaqtqtgeanrgwtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraaleal
    gsclnnkysegypgkryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanl
    avytallqphdrimgldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynq
    laltarlfrprliiagtsayarlidyarmrevcdevkahlladmahisglvaakvipspf
    khadivtttthktlrgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggph
    nhaiaavavalkqactpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrp
    kgldgaraervlelvsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfi
    degvniglevksktaklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v7iA (A:)
    wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
    kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
    gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
    agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
    rgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggphnhaiaavavalkqa
    ctpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlel
    vsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevkskt
    aklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v7iB (B:)
    snaaqtqtgeanrgwtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraaleal
    gsclnnkysegypgkryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanl
    avytallqphdrimgldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynq
    laltarlfrprliiagtsayarlidyarmrevcdevkahlladmahisglvaakvipspf
    khadivtttthktlrgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggph
    nhaiaavavalkqactpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrp
    kgldgaraervlelvsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfi
    degvniglevksktaklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v7iB (B:)
    wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
    kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
    gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
    agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
    rgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggphnhaiaavavalkqa
    ctpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlel
    vsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevkskt
    aklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh