PDB entry 5v7e

View 5v7e on RCSB PDB site
Description: T4 lysozyme Y18Ymcl
Class: hydrolase
Keywords: T4 lysozyme, Halogen bonds, Protein Engineering, Unnatural amino acids, HYDROLASE
Deposited on 2017-03-20, released 2018-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: e, T4Tp126
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9IEF7 (0-End)
      • conflict (53)
      • conflict (96)
    Domains in SCOPe 2.08: d5v7ea_
  • Heterogens: HED, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v7eA (A:)
    mnifemlrideglrlkixkdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v7eA (A:)
    mnifemlrideglrlkixkdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk