PDB entry 5v5j

View 5v5j on RCSB PDB site
Description: oxyferrous Dehaloperoxidase B
Class: oxygen transport
Keywords: peroxidase, peroxygenase, globin, OXYGEN TRANSPORT
Deposited on 2017-03-14, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase B
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v5ja_
  • Chain 'B':
    Compound: Dehaloperoxidase B
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v5jb_
  • Heterogens: HEM, SO4, OXY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v5jA (A:)
    gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v5jB (B:)
    gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk