PDB entry 5v4v

View 5v4v on RCSB PDB site
Description: Saccharomyces cerevisiae Old Yellow Enzyme 3
Class: oxidoreductase
Keywords: OYE, flavoprotein, reductase, OXIDOREDUCTASE
Deposited on 2017-03-10, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH dehydrogenase 3
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: OYE3, YPL171C, P2291
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v4va_
  • Chain 'B':
    Compound: NADPH dehydrogenase 3
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: OYE3, YPL171C, P2291
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v4vb_
  • Heterogens: FMN, NCA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v4vA (A:)
    mpfvkgfepislrdtnlfepikigntqlahravmppltrmrathpgnipnkewaavyygq
    raqrpgtmiitegtfispqaggydnapgiwsdeqvaewkniflaihdcqsfawvqlwslg
    wasfpdvlardglrydcasdrvymnatlqekakdannlehsltkddikqyikdyihaakn
    siaagadgveihsangyllnqfldphsnkrtdeyggtienrarftlevvdalietigper
    vglrlspygtfnsmsggaepgiiaqysyvlgelekrakagkrlafvhlveprvtdpslve
    gegeysegtndfaysiwkgpiiragnyalhpevvreqvkdprtligygrffisnpdlvyr
    leeglplnkydrstfytmsaegytdyptyeeavdlgwnkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v4vA (A:)
    pfvkgfepislrdtnlfepikigntqlahravmppltrmrathpgnipnkewaavyygqr
    aqrpgtmiitegtfispqaggydnapgiwsdeqvaewkniflaihdcqsfawvqlwslgw
    asfpdvlardglrydcasdrvymnatlqekakdannlehsltkddikqyikdyihaakns
    iaagadgveihsangyllnqfldphsnkrtdeyggtienrarftlevvdalietigperv
    glrlspygtfnsmsggaepgiiaqysyvlgelekrakagkrlafvhlveprvtdpslveg
    egeysegtndfaysiwkgpiiragnyalhpevvreqvkdprtligygrffisnpdlvyrl
    eeglplnkydrstfytmsaegytdyptyeeavdlgwn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v4vB (B:)
    mpfvkgfepislrdtnlfepikigntqlahravmppltrmrathpgnipnkewaavyygq
    raqrpgtmiitegtfispqaggydnapgiwsdeqvaewkniflaihdcqsfawvqlwslg
    wasfpdvlardglrydcasdrvymnatlqekakdannlehsltkddikqyikdyihaakn
    siaagadgveihsangyllnqfldphsnkrtdeyggtienrarftlevvdalietigper
    vglrlspygtfnsmsggaepgiiaqysyvlgelekrakagkrlafvhlveprvtdpslve
    gegeysegtndfaysiwkgpiiragnyalhpevvreqvkdprtligygrffisnpdlvyr
    leeglplnkydrstfytmsaegytdyptyeeavdlgwnkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v4vB (B:)
    pfvkgfepislrdtnlfepikigntqlahravmppltrmrathpgnipnkewaavyygqr
    aqrpgtmiitegtfispqaggydnapgiwsdeqvaewkniflaihdcqsfawvqlwslgw
    asfpdvlardglrydcasdrvymnatlqekakdannlehsltkddikqyikdyihaakns
    iaagadgveihsangyllnqfldphsnkrtdeyggtienrarftlevvdalietigperv
    glrlspygtfnsmsggaepgiiaqysyvlgelekrakagkrlafvhlveprvtdpslveg
    egeysegtndfaysiwkgpiiragnyalhpevvreqvkdprtligygrffisnpdlvyrl
    eeglplnkydrstfytmsaegytdyptyeeavdlgwn