PDB entry 5v48

View 5v48 on RCSB PDB site
Description: Soluble rabbit neprilysin in complex with thiorphan
Class: hydrolase
Keywords: Neutral Endopeptidase, Proteinase, Zn-dependent, HYDROLASE
Deposited on 2017-03-08, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neprilysin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: MME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08049 (0-695)
      • variant (139)
      • variant (308)
      • conflict (312)
      • conflict (316)
    Domains in SCOPe 2.07: d5v48a_
  • Chain 'B':
    Compound: Neprilysin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: MME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08049 (0-695)
      • variant (139)
      • variant (308)
      • conflict (312)
      • conflict (316)
    Domains in SCOPe 2.07: d5v48b_
  • Heterogens: ZN, TIO, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v48A (A:)
    gickssdciksaarliqnmdataepctdffkyacggwlkrnvipetssrysnfdilrdel
    evilkdvlqepktedivavqkaktlyrscvnetaidsrggqpllkllpdvygwpvatqnw
    eqtygtswsaeksiaqlnskygkkvlinffvgtddknsmnhiihidqprlglpsrdyyec
    tgiykeactayvdfmiavaklirqeeglpidenqisvemnkvmelekeianattksedrn
    dpmllynkmtlaqiqnnfsleingkpfswsnftneimstvninipneedvvvyapeylik
    lkpiltkysprdlqnlmswrfimdlvsslsrtykdsrnafrkalygttsesatwrrcany
    vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkkaeekal
    aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
    witgaaivnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
    rnfnkdgdlvdwwtqqsannfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
    igqayrayqnyvkkngeekllpgidlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
    gnfriigslqnsvefseafqcpknsymnpekkcrvw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v48B (B:)
    gickssdciksaarliqnmdataepctdffkyacggwlkrnvipetssrysnfdilrdel
    evilkdvlqepktedivavqkaktlyrscvnetaidsrggqpllkllpdvygwpvatqnw
    eqtygtswsaeksiaqlnskygkkvlinffvgtddknsmnhiihidqprlglpsrdyyec
    tgiykeactayvdfmiavaklirqeeglpidenqisvemnkvmelekeianattksedrn
    dpmllynkmtlaqiqnnfsleingkpfswsnftneimstvninipneedvvvyapeylik
    lkpiltkysprdlqnlmswrfimdlvsslsrtykdsrnafrkalygttsesatwrrcany
    vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkkaeekal
    aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
    witgaaivnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
    rnfnkdgdlvdwwtqqsannfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
    igqayrayqnyvkkngeekllpgidlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
    gnfriigslqnsvefseafqcpknsymnpekkcrvw