PDB entry 5v43

View 5v43 on RCSB PDB site
Description: Engineered human IgG Fc domain aglyco801
Class: immune system
Keywords: antibody engineering, Fc fragment, IMMUNE SYSTEM
Deposited on 2017-03-08, released 2017-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (78)
      • conflict (99)
      • conflict (165)
    Domains in SCOPe 2.06: d5v43a1, d5v43a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (78)
      • conflict (99)
      • conflict (165)
    Domains in SCOPe 2.06: d5v43b1, d5v43b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v43A (A:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynslyrvvsvltvlhqdwlngkeyeckvsnkalpapiektiskak
    gqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngrpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v43A (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynslyrvvsvltvlhqdwlngkeyeckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngrpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v43B (B:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynslyrvvsvltvlhqdwlngkeyeckvsnkalpapiektiskak
    gqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngrpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v43B (B:)
    ggpsvflfppkpktpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynslyrv
    vsvltvlhqdwlngkeyeckvsnkalpapiektiskakgqprepqvytlppsrdeltknq
    vsltclvkgfypsdiavewesngrpennykttppvldsdgsfflyskltvdksrwqqgnv
    fscsvmhealhnhytqkslsls