PDB entry 5v3c

View 5v3c on RCSB PDB site
Description: Crystal structure of TGT in complex with 4-(aminomethane)cyclohexane-1-carboxylic acid
Class: transferase
Keywords: TGT, TRNA, Guanine exchange enzyme, transglycosylase, transferase
Deposited on 2017-03-07, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720 (0-374)
      • conflict (302)
    Domains in SCOPe 2.07: d5v3ca_
  • Heterogens: ZN, AMH, PEG, DMS, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v3cA (A:)
    drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
    ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshld
    gsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsr
    keqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvp
    mlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfse
    dlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegr
    fsqfaqdfraryfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v3cA (A:)
    drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
    ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslstkqseegvtfkshldgs
    rhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrke
    qaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpml
    pddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedl
    kpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfs
    qfaqdfraryfar