PDB entry 5v39

View 5v39 on RCSB PDB site
Description: Crystal structure of human vitamin D receptor ligand binding domain in complex with a VDRM
Class: protein binding
Keywords: vdr, lbd, vdrm, protein binding
Deposited on 2017-03-06, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11473
      • conflict (52)
    Domains in SCOPe 2.07: d5v39a_
  • Heterogens: 8VM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v39A (A:)
    slrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlellqlsmlph
    ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
    nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
    alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
    csmkltplvlevfgneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v39A (A:)
    pklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlellqlsmlphlad
    lvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgnqd
    ykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaali
    eaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpecsm
    kltplvlevfg