PDB entry 5v38

View 5v38 on RCSB PDB site
Description: Crystal Structure of The Receptor-binding Domain of Botulinum Neurotoxin Type HA
Class: toxin
Keywords: botulinum neurotoxin (BoNT); BoNT/HA; BoNT/H; BoNT/FA; receptor-binding domain; host receptor; neutralizing antibody, TOXIN
Deposited on 2017-03-06, released 2017-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HcHA
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5V38 (Start-426)
    Domains in SCOPe 2.06: d5v38a1, d5v38a2
  • Chain 'B':
    Compound: HcHA
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5V38 (0-426)
    Domains in SCOPe 2.06: d5v38b1, d5v38b2
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v38A (A:)
    kyncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnlesskievilnng
    viynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnmnskiiwtlqd
    tegikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlineesisdlgniha
    snnimfkldgcrdphryiwikyfnlfdkelnkkeikdlydnqsnsgilkdfwgdylqydk
    pyymlnlydpnkyldvnnvgirgymylkgprgrivttniylnstlymgtkfiikkyasgn
    kdnivrnndrvyinvvvknkeyrlatnasqagvekilsaveipdvgnlsqvvvmksendq
    girnkckmnlqdnngndigfigfhqfnniaklvasnwynrqigkasrtfgcswefipvdd
    gwgessl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v38A (A:)
    yncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnlesskievilnngv
    iynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnmnskiiwtlqdt
    egikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlineesisdlgnihas
    nnimfkldgcrdphryiwikyfnlfdkelnkkeikdlydnqsnsgilkdfwgdylqydkp
    yymlnlydpnkyldvnnvgirgymylkgprgrivttniylnstlymgtkfiikkyasgnk
    dnivrnndrvyinvvvknkeyrlatnasqagvekilsaveipdvgnlsqvvvmksendqg
    irnkckmnlqdnngndigfigfhqfnniaklvasnwyntfgcswefipvddgwgessl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v38B (B:)
    kyncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnlesskievilnng
    viynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnmnskiiwtlqd
    tegikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlineesisdlgniha
    snnimfkldgcrdphryiwikyfnlfdkelnkkeikdlydnqsnsgilkdfwgdylqydk
    pyymlnlydpnkyldvnnvgirgymylkgprgrivttniylnstlymgtkfiikkyasgn
    kdnivrnndrvyinvvvknkeyrlatnasqagvekilsaveipdvgnlsqvvvmksendq
    girnkckmnlqdnngndigfigfhqfnniaklvasnwynrqigkasrtfgcswefipvdd
    gwgessl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v38B (B:)
    kyncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnlesskievilnng
    viynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnmnskiiwtlqd
    tegikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlineesisdlgniha
    snnimfkldgcrdphryiwikyfnlfdkelnkkeikdlydnqsnsgilkdfwgdylqydk
    pyymlnlydpnkyldvnnvgirgymylkgprgrivttniylnstlymgtkfiikkyasgn
    kdnivrnndrvyinvvvknkeyrlatnasqagvekilsaveipdvgnlsqvvvmksendq
    girnkckmnlqdnngndigfigfhqfnniaklvasnwygcswefipvddgwgessl