PDB entry 5v26

View 5v26 on RCSB PDB site
Description: 1.78 angstrom crystal structure of P97H 3-hydroxyanthranilate-3,4-dioxygenase from Cupriavidus metallidurans
Class: oxidoreductase
Keywords: HAO Kynurenine Cupin Dioxygenase, OXIDOREDUCTASE
Deposited on 2017-03-02, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) [TaxId:266264]
    Gene: nbaC, Rmet_5193
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1LCS4 (27-End)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d5v26a_
  • Chain 'B':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) [TaxId:266264]
    Gene: nbaC, Rmet_5193
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1LCS4 (27-End)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d5v26b_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v26A (A:)
    mgsshhhhhhssglvprgsenlyfqghmltygapfnfprwidehahllkppvgnrqvwqd
    sdfivtvvggpnhrtdyhddpleeffyqlrgnaylnlwvdgrreradlkegdifllpphv
    rhshqrpeagsaclvierqrpagmldgfewycdacghlvhrvevqlksivtdlpplfesf
    yasedkrrcphcgqvhpgraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v26A (A:)
    mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
    qlrgnaylnlwvdgrreradlkegdifllpphvrhshqrpeagsaclvierqrpagmldg
    fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v26B (B:)
    mgsshhhhhhssglvprgsenlyfqghmltygapfnfprwidehahllkppvgnrqvwqd
    sdfivtvvggpnhrtdyhddpleeffyqlrgnaylnlwvdgrreradlkegdifllpphv
    rhshqrpeagsaclvierqrpagmldgfewycdacghlvhrvevqlksivtdlpplfesf
    yasedkrrcphcgqvhpgraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v26B (B:)
    mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
    qlrgnaylnlwvdgrreradlkegdifllpphvrhshqrpeagsaclvierqrpagmldg
    fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgr