PDB entry 5v0z

View 5v0z on RCSB PDB site
Description: Crystal structure of Galactoside O-acetyltransferase complex with CoA (P32 space group).
Class: transferase
Keywords: Structural Genomics, CSGID, acetyltransferase, Coenzyme-A, Center for Structural Genomics of Infectious Diseases, TRANSFERASE
Deposited on 2017-02-28, released 2017-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative acetyltransferase SACOL2570
    Species: Staphylococcus aureus (strain COL) [TaxId:93062]
    Gene: SACOL2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v0za_
  • Chain 'B':
    Compound: Putative acetyltransferase SACOL2570
    Species: Staphylococcus aureus (strain COL) [TaxId:93062]
    Gene: SACOL2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v0zb_
  • Chain 'C':
    Compound: Putative acetyltransferase SACOL2570
    Species: Staphylococcus aureus (strain COL) [TaxId:93062]
    Gene: SACOL2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v0zc_
  • Heterogens: EDO, PO4, CL, COA, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v0zA (A:)
    snamtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtt
    tdnvsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathpln
    fhhrnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnp
    ckvvrkidndlpsetlndetik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v0zA (A:)
    mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
    vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
    rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
    vrkidndlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v0zB (B:)
    snamtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtt
    tdnvsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathpln
    fhhrnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnp
    ckvvrkidndlpsetlndetik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v0zB (B:)
    mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
    vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
    rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
    vrkidndlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5v0zC (C:)
    snamtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtt
    tdnvsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathpln
    fhhrnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnp
    ckvvrkidndlpsetlndetik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v0zC (C:)
    mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
    vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
    rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
    vrkidndlp