PDB entry 5v0x

View 5v0x on RCSB PDB site
Description: Crystal structure of glycylpeptide N-tetradecanoyltransferase from Plasmodium vivax in complex with inhibitor IMP-0001114
Class: transferase/transferase inhibitor
Keywords: SSGCID, glycylpeptide N-tetradecanoyltransferase, N-myristoyltransferase, NMT, Plasmodium vival, Salvador I, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-02-28, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycylpeptide N-tetradecanoyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_130042700, PVP01_1336100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v0xa1, d5v0xa2, d5v0xa3
  • Chain 'B':
    Compound: Glycylpeptide N-tetradecanoyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_130042700, PVP01_1336100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v0xb1, d5v0xb2, d5v0xb3
  • Chain 'C':
    Compound: Glycylpeptide N-tetradecanoyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_130042700, PVP01_1336100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v0xc1, d5v0xc2, d5v0xc3
  • Heterogens: MYA, 8RD, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v0xA (A:)
    mgsshhhhhhsaalevlfqgpdykfwytqpvpkindefnesvnepfisdnkvedvrkdey
    klppgyswyvcdvkdekdrseiytlltdnyvedddnifrfnysaefllwaltspnylktw
    higvkydasnkligfisaiptdicihkrtikmaevnflcvhktlrskrlapvlikeitrr
    inleniwqaiytagvylpkpvsdaryyhrsinvkklieigfsslnsrltmsraiklyrve
    dtlniknmrlmkkkdvegvhkllgsyleqfnlyavftkeeiahwflpienviytyvneen
    gkikdmisfyslpsqilgndkystlnaaysfynvtttatfkqlmqdaillakrnnfdvfn
    alevmqnksvfedlkfgegdgslkyylynwkcasfapahvgivll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v0xA (A:)
    pdykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
    eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
    tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
    vsdaryyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvh
    kllgsyleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgnd
    kystlnaaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegd
    gslkyylynwkcasfapahvgivll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v0xB (B:)
    mgsshhhhhhsaalevlfqgpdykfwytqpvpkindefnesvnepfisdnkvedvrkdey
    klppgyswyvcdvkdekdrseiytlltdnyvedddnifrfnysaefllwaltspnylktw
    higvkydasnkligfisaiptdicihkrtikmaevnflcvhktlrskrlapvlikeitrr
    inleniwqaiytagvylpkpvsdaryyhrsinvkklieigfsslnsrltmsraiklyrve
    dtlniknmrlmkkkdvegvhkllgsyleqfnlyavftkeeiahwflpienviytyvneen
    gkikdmisfyslpsqilgndkystlnaaysfynvtttatfkqlmqdaillakrnnfdvfn
    alevmqnksvfedlkfgegdgslkyylynwkcasfapahvgivll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v0xB (B:)
    pdykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
    eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
    tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
    vsdaryyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvh
    kllgsyleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgnd
    kystlnaaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegd
    gslkyylynwkcasfapahvgivll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5v0xC (C:)
    mgsshhhhhhsaalevlfqgpdykfwytqpvpkindefnesvnepfisdnkvedvrkdey
    klppgyswyvcdvkdekdrseiytlltdnyvedddnifrfnysaefllwaltspnylktw
    higvkydasnkligfisaiptdicihkrtikmaevnflcvhktlrskrlapvlikeitrr
    inleniwqaiytagvylpkpvsdaryyhrsinvkklieigfsslnsrltmsraiklyrve
    dtlniknmrlmkkkdvegvhkllgsyleqfnlyavftkeeiahwflpienviytyvneen
    gkikdmisfyslpsqilgndkystlnaaysfynvtttatfkqlmqdaillakrnnfdvfn
    alevmqnksvfedlkfgegdgslkyylynwkcasfapahvgivll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v0xC (C:)
    pdykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
    eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
    tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
    vsdaryyhrsinvkklieigfiklyrvedtlniknmrlmkkkdvegvhkllgsyleqfnl
    yavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgndkystlnaaysfy
    nvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegdgslkyylynwkc
    asfapahvgivll