PDB entry 5v0v

View 5v0v on RCSB PDB site
Description: Crystal structure of Equine Serum Albumin complex with etodolac
Class: transport protein
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, Equine Serum Albumin, Etodolac, CSGID, TRANSPORT PROTEIN
Deposited on 2017-02-28, released 2017-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35747 (Start-582)
      • conflict (559)
    Domains in SCOPe 2.06: d5v0va1, d5v0va2, d5v0va3
  • Heterogens: TRS, SO4, 8QP, 8QS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v0vA (A:)
    dthkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesae
    ncdkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepd
    aqcaafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipk
    ldalkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkv
    hkecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsd
    lpalaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekcc
    aeadppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstp
    tlveigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdsl
    aerrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatk
    eqlktvlgnfsafvakccgaedkeacfaeegpklvassqlala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v0vA (A:)
    hkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaenc
    dkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaq
    caafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipkld
    alkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhk
    ecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlp
    alaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccae
    adppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptl
    veigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslae
    rrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeq
    lktvlgnfsafvakccgaedkeacfaeegpklvassqlala