PDB entry 5v0i

View 5v0i on RCSB PDB site
Description: Crystal Structure of Tryptophanyl-tRNA Synthetase from Escherichia coli Complexed with AMP and Tryptophan
Class: ligase
Keywords: CSGID, tryptophanyl-tRNA synthetase, a/b sandwich, Structural Genomics, Center for Structural Genomics of Infectious Diseases, ligase
Deposited on 2017-02-28, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan--tRNA ligase
    Species: Escherichia coli O157:H7 str. EDL933 [TaxId:155864]
    Gene: trpS, Z4737, ECs4226
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v0ia_
  • Chain 'B':
    Compound: Tryptophan--tRNA ligase
    Species: Escherichia coli O157:H7 str. EDL933 [TaxId:155864]
    Gene: trpS, Z4737, ECs4226
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v0ib_
  • Heterogens: AMP, TRP, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v0iA (A:)
    snamtkpivfsgaqpsgeltignymgalrqwvnmqddyhciycivdqhaitvrqdaqklr
    katldtlalylacgidpekstifvqshvpehaqlgwalncytyfgelsrmtqfkdksary
    aeninaglfdypvlmaadillyqtnlvpvgedqkqhlelsrdiaqrfnalygdifkvpep
    fipksgarvmslleptkkmsksddnrnnviglledpksvvkkikravtdsdeppvvrydv
    qnkagvsnlldilsavtgqsipelekqfegkmyghlkgevadavsgmltelqeryhrfrn
    deaflqqvmkdgaekasahasrtlkavyeaigfvakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v0iA (A:)
    kpivfsgaqpsltignymgalrqwvnmqddyhciycivdqhaitvrqdaqklrkatldtl
    alylacgidpekstifvqshvpehaqlgwalncytyfgelsrmtaeninaglfdypvlma
    adillyqtnlvpvgedqkqhlelsrdiaqrfnalygdifkvpepfipksgarvmsllept
    kkmsksddnrnnviglledpksvvkkikravtdsdeppvvrydvqnkagvsnlldilsav
    tgqsipelekqfegkmyghlkgevadavsgmltelqeryhrfrndeaflqqvmkdgaeka
    sahasrtlkavyeaigfvakp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v0iB (B:)
    snamtkpivfsgaqpsgeltignymgalrqwvnmqddyhciycivdqhaitvrqdaqklr
    katldtlalylacgidpekstifvqshvpehaqlgwalncytyfgelsrmtqfkdksary
    aeninaglfdypvlmaadillyqtnlvpvgedqkqhlelsrdiaqrfnalygdifkvpep
    fipksgarvmslleptkkmsksddnrnnviglledpksvvkkikravtdsdeppvvrydv
    qnkagvsnlldilsavtgqsipelekqfegkmyghlkgevadavsgmltelqeryhrfrn
    deaflqqvmkdgaekasahasrtlkavyeaigfvakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v0iB (B:)
    tkpivfsgaqpsgeltignymgalrqwvnmqddyhciycivdqhaitvrqdaqklrkatl
    dtlalylacgidpekstifvqshvpehaqlgwalncytyfgelsrmtqfkaryaeninag
    lfdypvlmaadillyqtnlvpvgedqkqhlelsrdiaqrfnalygdifkvpepfarvmsl
    leptkkmsksddnrnnviglledpksvvkkikravtdsdeppvvrydvqnkagvsnlldi
    lsavtgqsipelekqfegkmyghlkgevadavsgmltelqeryhrfrndeaflqqvmkdg
    aekasahasrtlkavyeaigfvakp