PDB entry 5v00

View 5v00 on RCSB PDB site
Description: Structure of HutD from Pseudomonas fluorescens SBW25 (Formate condition)
Class: unknown function
Keywords: bicupin, histidine degradation, UNKNOWN FUNCTION
Deposited on 2017-02-27, released 2017-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Pseudomonas fluorescens (strain SBW25) [TaxId:216595]
    Gene: PFLU_0360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v00a_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Pseudomonas fluorescens (strain SBW25) [TaxId:216595]
    Gene: PFLU_0360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v00b_
  • Heterogens: GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v00A (A:)
    mghhhhhhsaisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggf
    ssfagyqrvitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliy
    speryharlqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisv
    tgrcclieltqrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v00A (A:)
    aisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqrv
    itviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyharl
    qwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrccliel
    tqrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v00B (B:)
    mghhhhhhsaisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggf
    ssfagyqrvitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliy
    speryharlqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisv
    tgrcclieltqrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v00B (B:)
    saisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqr
    vitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyhar
    lqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrcclie
    ltqrg