PDB entry 5uzx

View 5uzx on RCSB PDB site
Description: Crystal Structure of Putative short-chain dehydrogenase/reductase from Burkholderia multivorans with bound NADP
Class: oxidoreductase
Keywords: dehydrogenase/reductase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE
Deposited on 2017-02-27, released 2017-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative short-chain alcohol dehydrogenase
    Species: Burkholderia multivorans (strain ATCC 17616 / 249) [TaxId:395019]
    Gene: BMULJ_04988
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uzxa_
  • Chain 'B':
    Compound: Putative short-chain alcohol dehydrogenase
    Species: Burkholderia multivorans (strain ATCC 17616 / 249) [TaxId:395019]
    Gene: BMULJ_04988
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uzxb_
  • Heterogens: NAP, CL, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uzxA (A:)
    mahhhhhhmpdtsdprptillvgasrglghamaaeflkrgwdvvgtvradrgrtplhala
    eaypdrlrietlditqpeqiralaarlsgrvfdilfvnagttnpdptqtigevstddfvd
    lmitnalspmrvvetlaglvprdgligimssgqgsiadnesgqrelyrgskaalnqfmrs
    faarhaqtplamvliapgwvrtelggpdarlsidesvpgvvdvllakrgragleyldyrg
    rtvrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzxA (A:)
    prptillvgasrglghamaaeflkrgwdvvgtvradrgrtplhalaeaypdrlrietldi
    tqpeqiralaarlsgrvfdilfvnagttnpdptqtigevstddfvdlmitnalspmrvve
    tlaglvprdgligimssgqgsiadnesgqrelyrgskaalnqfmrsfaarhaqtplamvl
    iapgwvrtelggpdarlsidesvpgvvdvllakrgragleyldyrgrtvrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uzxB (B:)
    mahhhhhhmpdtsdprptillvgasrglghamaaeflkrgwdvvgtvradrgrtplhala
    eaypdrlrietlditqpeqiralaarlsgrvfdilfvnagttnpdptqtigevstddfvd
    lmitnalspmrvvetlaglvprdgligimssgqgsiadnesgqrelyrgskaalnqfmrs
    faarhaqtplamvliapgwvrtelggpdarlsidesvpgvvdvllakrgragleyldyrg
    rtvrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzxB (B:)
    prptillvgasrglghamaaeflkrgwdvvgtvradrgrtplhalaeaypdrlrietldi
    tqpeqiralaarlsgrvfdilfvnagttnpdptqtigevstddfvdlmitnalspmrvve
    tlaglvprdgligimssgqgsiadnesgqrelyrgskaalnqfmrsfaarhaqtplamvl
    iapgwvrtelggpdarlsidesvpgvvdvllakrgragleyldyrgrtvrw