PDB entry 5uzp

View 5uzp on RCSB PDB site
Description: Crystal structure of citrate synthase mutant A348G from homo sapiens
Class: transferase
Keywords: transferase
Deposited on 2017-02-27, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Citrate synthase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75390 (23-End)
      • engineered mutation (343)
    Domains in SCOPe 2.07: d5uzpa_
  • Chain 'B':
    Compound: Citrate synthase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75390 (23-End)
      • engineered mutation (343)
    Domains in SCOPe 2.07: d5uzpb_
  • Heterogens: OAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uzpA (A:)
    mhhhhhhssgvdlgtenlyfqsnasstnlkdiladlipkeqariktfrqqhgktvvgqit
    vdmmyggmrgmkglvyetsvldpdegirfrgfsipecqkllpkakggeeplpeglfwllv
    tghipteeqvswlskewakraalpshvvtmldnfptnlhpmsqlsaavtalnsesnfara
    yaqgisrtkyweliyedsmdliaklpcvaakiyrnlyregsgigaidsnldwshnftnml
    gytdhqfteltrlyltihsdheggnvsahtshlvgsalsdpylsfaaamnglagplhgla
    nqevlvwltqlqkevgkdvsdeklrdyiwntlnsgrvvpgyghgvlrktdprytcqrefa
    lkhlpndpmfklvaqlykivpnvlleqgkaknpwpnvdahsgvllqyygmtemnyytvlf
    gvsralgvlaqliwsralgfplerpksmsteglmkfvdsksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzpA (A:)
    asstnlkdiladlipkeqariktfrqqhgktvvgqitvdmmyggmrgmkglvyetsvldp
    degirfrgfsipecqkllpkakggeeplpeglfwllvtghipteeqvswlskewakraal
    pshvvtmldnfptnlhpmsqlsaavtalnsesnfarayaqgisrtkyweliyedsmdlia
    klpcvaakiyrnlyregsgigaidsnldwshnftnmlgytdhqfteltrlyltihsdheg
    gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
    lrdyiwntlnsgrvvpgyghgvlrktdprytcqrefalkhlpndpmfklvaqlykivpnv
    lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
    rpksmsteglmkfvds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uzpB (B:)
    mhhhhhhssgvdlgtenlyfqsnasstnlkdiladlipkeqariktfrqqhgktvvgqit
    vdmmyggmrgmkglvyetsvldpdegirfrgfsipecqkllpkakggeeplpeglfwllv
    tghipteeqvswlskewakraalpshvvtmldnfptnlhpmsqlsaavtalnsesnfara
    yaqgisrtkyweliyedsmdliaklpcvaakiyrnlyregsgigaidsnldwshnftnml
    gytdhqfteltrlyltihsdheggnvsahtshlvgsalsdpylsfaaamnglagplhgla
    nqevlvwltqlqkevgkdvsdeklrdyiwntlnsgrvvpgyghgvlrktdprytcqrefa
    lkhlpndpmfklvaqlykivpnvlleqgkaknpwpnvdahsgvllqyygmtemnyytvlf
    gvsralgvlaqliwsralgfplerpksmsteglmkfvdsksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzpB (B:)
    asstnlkdiladlipkeqariktfrqqhgktvvgqitvdmmyggmrgmkglvyetsvldp
    degirfrgfsipecqkllpkakggeeplpeglfwllvtghipteeqvswlskewakraal
    pshvvtmldnfptnlhpmsqlsaavtalnsesnfarayaqgisrtkyweliyedsmdlia
    klpcvaakiyrnlyregsgigaidsnldwshnftnmlgytdhqfteltrlyltihsdheg
    gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
    lrdyiwntlnsgrvvpgyghgvlrktdprytcqrefalkhlpndpmfklvaqlykivpnv
    lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
    rpksmsteglmkfvds