PDB entry 5uzh

View 5uzh on RCSB PDB site
Description: Crystal structure of a GDP-mannose dehydratase from Naegleria fowleri
Class: transferase
Keywords: SSGCID, Naegleria fowleri, kinase, nucloside diphosphate, potential drug target, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2017-02-26, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NafoA.00085.b
    Species: Naegleria fowleri [TaxId:5763]
    Database cross-references and differences (RAF-indexed):
    • PDB 5UZH (0-344)
    Domains in SCOPe 2.07: d5uzha_
  • Heterogens: GDP, NAP, MPD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5uzhA (A:)
    skvalitgitgqdgsylaefllekgymvygiirrsssfntgrvehlykdihitkakfkll
    ygdltdtgnlisiiakikpdeiynlaaqshvkvsfempeytanvdgigtlrlleairacg
    lekktkfyqastselyglvqevpqkettpfyprspyacaklysywivvnyreaynmfaln
    gilfnhesirrgptfvtrkitmavariklglqdclylgnldaerdwghakdyveamwlml
    qqeqprdfcvatgekhsvrefvekafacigqtvewkgergtveehgvvdgvvrvrvdpry
    frptevdqllgdptlaetvlgwkrkvsfeelvrgmvegdiellqs