PDB entry 5uzc

View 5uzc on RCSB PDB site
Description: Crystal Structure of Inosine 5'-monophosphate Dehydrogenase from Clostridium perfringens Complexed with IMP and P221
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: TIM barrel, IMPDH, CSGID, Structural Genomics, Center for Structural Genomics of Infectious Diseases, OXIDOREDUCTASE, oxidoreductase-oxidoreductase inhibitor complex
Deposited on 2017-02-26, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) [TaxId:195103]
    Gene: guaB, CPF_2558
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uzca_
  • Chain 'B':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) [TaxId:195103]
    Gene: guaB, CPF_2558
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uzcb1, d5uzcb2
  • Chain 'C':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) [TaxId:195103]
    Gene: guaB, CPF_2558
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uzcc_
  • Chain 'D':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) [TaxId:195103]
    Gene: guaB, CPF_2558
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uzcd1, d5uzcd2
  • Heterogens: IMP, 8N1, MPD, ACY, FMT, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uzcA (A:)
    snamarilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskm
    aiamareggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvd
    vivldtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgs
    icttrivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsi
    fagceeapgaieiyqgrsykvyrgmgslgamakgssdryfqngtkkfvpegvegriaykg
    hladtiyqliggiksgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnys
    vnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzcA (A:)
    arilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiam
    areggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivl
    dtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsictt
    rivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagc
    eeapgaieiyqgrsykvyrgmgslgamakfvpegvegriaykghladtiyqliggiksgm
    gylgaptlenlyenanfvvqtsagfreshphdinitkeapnysv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uzcB (B:)
    snamarilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskm
    aiamareggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvd
    vivldtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgs
    icttrivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsi
    fagceeapgaieiyqgrsykvyrgmgslgamakgssdryfqngtkkfvpegvegriaykg
    hladtiyqliggiksgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnys
    vnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzcB (B:)
    snamarilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskm
    aiamareggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvd
    vivldtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgs
    icttrivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsi
    fagceeapgaieiyqgrsykvyrgmgslgamafvpegvegriaykghladtiyqliggik
    sgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnysv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5uzcC (C:)
    snamarilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskm
    aiamareggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvd
    vivldtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgs
    icttrivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsi
    fagceeapgaieiyqgrsykvyrgmgslgamakgssdryfqngtkkfvpegvegriaykg
    hladtiyqliggiksgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnys
    vnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzcC (C:)
    arilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiam
    areggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivl
    dtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsictt
    rivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagc
    eeapgaieiyqgrsykvyrgmgslgamafvpegvegriaykghladtiyqliggiksgmg
    ylgaptlenlyenanfvvqtsagfreshphdinitkeapnys
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5uzcD (D:)
    snamarilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskm
    aiamareggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvd
    vivldtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgs
    icttrivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsi
    fagceeapgaieiyqgrsykvyrgmgslgamakgssdryfqngtkkfvpegvegriaykg
    hladtiyqliggiksgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnys
    vnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzcD (D:)
    namarilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskma
    iamareggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdv
    ivldtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsi
    cttrivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsif
    agceeapgaieiyqgrsykvyrgmgslgamavpegvegriaykghladtiyqliggiksg
    mgylgaptlenlyenanfvvqtsagfreshphdinitkeapnysv