PDB entry 5uz0

View 5uz0 on RCSB PDB site
Description: Crystal structure of AICARFT bound to an antifolate
Class: transferase, hydrolase
Keywords: aicar, aicarft, amz, transferase, hydrolase
Deposited on 2017-02-24, released 2018-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-10, with a file datestamp of 2018-01-05.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional purine biosynthesis protein PURH
    Species: Homo sapiens [TaxId:9606]
    Gene: ATIC, PURH, OK/SW-cl.86
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5uz0a1, d5uz0a2
  • Chain 'B':
    Compound: Bifunctional purine biosynthesis protein PURH
    Species: Homo sapiens [TaxId:9606]
    Gene: ATIC, PURH, OK/SW-cl.86
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5uz0b1, d5uz0b2
  • Chain 'C':
    Compound: Bifunctional purine biosynthesis protein PURH
    Species: Homo sapiens [TaxId:9606]
    Gene: ATIC, PURH, OK/SW-cl.86
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5uz0c1, d5uz0c2
  • Chain 'D':
    Compound: Bifunctional purine biosynthesis protein PURH
    Species: Homo sapiens [TaxId:9606]
    Gene: ATIC, PURH, OK/SW-cl.86
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5uz0d1, d5uz0d2
  • Heterogens: AMZ, MG, 8US, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uz0A (A:)
    mahhhhhhslapgqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdv
    seltgfpemlggrvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktva
    spgvtveeaveqidiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletr
    rqlalkafthtaqydeaisdyfrkqyskgvsqmplrygmnphqtpaqlytlqpklpitvl
    ngapgfinlcdalnawqlvkelkealgipaaasfkhvspagaavgiplsedeakvcmvyd
    lyktltpisaayarargadrmssfgdfvalsdvcdvptakiisrevsdgiiapgyeeeal
    tilskkkngnycvlqmdqsykpdenevrtlfglhlsqkrnngvvdkslfsnvvtknkdlp
    esalrdlivatiavkytqsnsvcyakngqvigigagqqsrihctrlagdkanywwlrhhp
    qvlsmkfktgvkraeisnaidqyvtgtigededlikwkalfeevpellteaekkewvekl
    tevsissdaffpfrdnvdrakrsgvayiaapsgsaadkvvieacdelgiilahtnlrlfh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uz0A (A:)
    gqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlgg
    rvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspgvtveeaveq
    idiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthta
    qydeaisdyfrkqyskgvsqmplrygmnphqtpaqlytlqpklpitvlngapgfinlcda
    lnawqlvkelkealgipaaasfkhvspagaavgiplsedeakvcmvydlyktltpisaay
    arargadrmssfgdfvalsdvcdvptakiisrevsdgiiapgyeeealtilskkkngnyc
    vlqmdqsykpdenevrtlfglhlsqkrnngvvdkslfsnvvtknkdlpesalrdlivati
    avkytqsnsvcyakngqvigigagqqsrihctrlagdkanywwlrhhpqvlsmkfktgvk
    raeisnaidqyvtgtigededlikwkalfeevpellteaekkewvekltevsissdaffp
    frdnvdrakrsgvayiaapsgsaadkvvieacdelgiilahtnlrlfhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uz0B (B:)
    mahhhhhhslapgqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdv
    seltgfpemlggrvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktva
    spgvtveeaveqidiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletr
    rqlalkafthtaqydeaisdyfrkqyskgvsqmplrygmnphqtpaqlytlqpklpitvl
    ngapgfinlcdalnawqlvkelkealgipaaasfkhvspagaavgiplsedeakvcmvyd
    lyktltpisaayarargadrmssfgdfvalsdvcdvptakiisrevsdgiiapgyeeeal
    tilskkkngnycvlqmdqsykpdenevrtlfglhlsqkrnngvvdkslfsnvvtknkdlp
    esalrdlivatiavkytqsnsvcyakngqvigigagqqsrihctrlagdkanywwlrhhp
    qvlsmkfktgvkraeisnaidqyvtgtigededlikwkalfeevpellteaekkewvekl
    tevsissdaffpfrdnvdrakrsgvayiaapsgsaadkvvieacdelgiilahtnlrlfh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uz0B (B:)
    gqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlgg
    rvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspgvtveeaveq
    idiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthta
    qydeaisdyfrkqyskgvsqmplrygmnphqtpaqlytlqpklpitvlngapgfinlcda
    lnawqlvkelkealgipaaasfkhvspagaavgiplsedeakvcmvydlyktltpisaay
    arargadrmssfgdfvalsdvcdvptakiisrevsdgiiapgyeeealtilskkkngnyc
    vlqmdqsykpdenevrtlfglhlsqkrnngvvdkslfsnvvtknkdlpesalrdlivati
    avkytqsnsvcyakngqvigigagqqsrihctrlagdkanywwlrhhpqvlsmkfktgvk
    raeisnaidqyvtgtigededlikwkalfeevpellteaekkewvekltevsissdaffp
    frdnvdrakrsgvayiaapsgsaadkvvieacdelgiilahtnlrlfhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5uz0C (C:)
    mahhhhhhslapgqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdv
    seltgfpemlggrvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktva
    spgvtveeaveqidiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletr
    rqlalkafthtaqydeaisdyfrkqyskgvsqmplrygmnphqtpaqlytlqpklpitvl
    ngapgfinlcdalnawqlvkelkealgipaaasfkhvspagaavgiplsedeakvcmvyd
    lyktltpisaayarargadrmssfgdfvalsdvcdvptakiisrevsdgiiapgyeeeal
    tilskkkngnycvlqmdqsykpdenevrtlfglhlsqkrnngvvdkslfsnvvtknkdlp
    esalrdlivatiavkytqsnsvcyakngqvigigagqqsrihctrlagdkanywwlrhhp
    qvlsmkfktgvkraeisnaidqyvtgtigededlikwkalfeevpellteaekkewvekl
    tevsissdaffpfrdnvdrakrsgvayiaapsgsaadkvvieacdelgiilahtnlrlfh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uz0C (C:)
    gqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlgg
    rvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspgvtveeaveq
    idiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthta
    qydeaisdyfrkqyskgvsqmplrygmnphqtpaqlytlqpklpitvlngapgfinlcda
    lnawqlvkelkealgipaaasfkhvspagaavgiplsedeakvcmvydlyktltpisaay
    arargadrmssfgdfvalsdvcdvptakiisrevsdgiiapgyeeealtilskkkngnyc
    vlqmdqsykpdenevrtlfglhlsqkrnngvvdkslfsnvvtknkdlpesalrdlivati
    avkytqsnsvcyakngqvigigagqqsrihctrlagdkanywwlrhhpqvlsmkfktgvk
    raeisnaidqyvtgtigededlikwkalfeevpellteaekkewvekltevsissdaffp
    frdnvdrakrsgvayiaapsgsaadkvvieacdelgiilahtnlrlfhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5uz0D (D:)
    mahhhhhhslapgqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdv
    seltgfpemlggrvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktva
    spgvtveeaveqidiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletr
    rqlalkafthtaqydeaisdyfrkqyskgvsqmplrygmnphqtpaqlytlqpklpitvl
    ngapgfinlcdalnawqlvkelkealgipaaasfkhvspagaavgiplsedeakvcmvyd
    lyktltpisaayarargadrmssfgdfvalsdvcdvptakiisrevsdgiiapgyeeeal
    tilskkkngnycvlqmdqsykpdenevrtlfglhlsqkrnngvvdkslfsnvvtknkdlp
    esalrdlivatiavkytqsnsvcyakngqvigigagqqsrihctrlagdkanywwlrhhp
    qvlsmkfktgvkraeisnaidqyvtgtigededlikwkalfeevpellteaekkewvekl
    tevsissdaffpfrdnvdrakrsgvayiaapsgsaadkvvieacdelgiilahtnlrlfh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uz0D (D:)
    gqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlgg
    rvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspvtveeaveqi
    diggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthtaq
    ydeaisdyfrkqyskgvsqmplrygmnphqtpaqlytlqpklpitvlngapgfinlcdal
    nawqlvkelkealgipaaasfkhvspagaavgiplsedeakvcmvydlyktltpisaaya
    rargadrmssfgdfvalsdvcdvptakiisrevsdgiiapgyeeealtilskkkngnycv
    lqmdqsykpdenevrtlfglhlsqkrnngvvdkslfsnvvtknkdlpesalrdlivatia
    vkytqsnsvcyakngqvigigagqqsrihctrlagdkanywwlrhhpqvlsmkfktgvkr
    aeisnaidqyvtgtigededlikwkalfeevpellteaekkewvekltevsissdaffpf
    rdnvdrakrsgvayiaapsgsaadkvvieacdelgiilahtnlrlfhh