PDB entry 5uwg

View 5uwg on RCSB PDB site
Description: The crystal structure of Fz4-CRD in complex with palmitoleic acid
Class: signaling protein
Keywords: Wnt, Frizzled, signalosome, cysteine-rich domain, Wnt5a, Wnt8, Frizzled-4, SIGNALING PROTEIN
Deposited on 2017-02-21, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frizzled-4
    Species: Homo sapiens [TaxId:9606]
    Gene: FZD4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uwga_
  • Chain 'B':
    Compound: Frizzled-4
    Species: Homo sapiens [TaxId:9606]
    Gene: FZD4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uwgb_
  • Heterogens: PAM, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uwgA (A:)
    eeerrcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflc
    svyvpmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcm
    egpgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uwgA (A:)
    rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
    pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqnhmcmegp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uwgB (B:)
    eeerrcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflc
    svyvpmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcm
    egpgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uwgB (B:)
    rcdpirismcqnlgynvtkmphelqtdaelqlttftpliqygcssqlqfflcsvyvpmct
    ekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp