PDB entry 5uvz

View 5uvz on RCSB PDB site
Description: BRD4 Bromodomain 2 with A-1354689
Class: signaling protein/inhibitor
Keywords: Helix bundle, SIGNALING PROTEIN-INHIBITOR complex
Deposited on 2017-02-20, released 2017-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 4
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD4, HUNK1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60885 (3-108)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d5uvza1, d5uvza2
• Heterogens: 8NP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5uvzA (A:)
  shmeqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
  areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakm