PDB entry 5uui

View 5uui on RCSB PDB site
Description: Crystal Structure of Spin-Labeled T77C TNFa
Class: immune system
Keywords: T77C, TNFa, TNF alpha, cytokine, immune system
Deposited on 2017-02-16, released 2017-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-157)
      • engineered mutation (77)
    Domains in SCOPe 2.07: d5uuia_
  • Heterogens: MTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uuiA (A:)
    svrsssrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliy
    sqvlfkgqgcpsthvllchtisriavsyqtkvnllsaikspcqretpegaeakpwyepiy
    lggvfqlekgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uuiA (A:)
    sdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkgqg
    vllchtisriavsyqtkvnllsaikspakpwyepiylggvfqlekgdrlsaeinrpdyld
    faesgqvyfgiial