PDB entry 5utj

View 5utj on RCSB PDB site
Description: Crystal Structure of TGT in complex with 2,6-dioxy-8-azapurine, 2,6-dioxy-8-azapurine, 2,6-dioxy-8-azapurine
Class: transferase
Keywords: TGT, tRNA, guanine exchange enzyme, transglycosylase, fragments, transferase
Deposited on 2017-02-15, released 2018-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720 (0-End)
      • conflict (302)
    Domains in SCOPe 2.08: d5utja_
  • Heterogens: ZN, PEG, DMS, AZA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5utjA (A:)
    drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
    ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshld
    gsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsr
    keqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvp
    mlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfse
    dlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegr
    fsqfaqdfraryfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5utjA (A:)
    drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
    ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmtkqseegvtfksrhmlsper
    sieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaalf
    giqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphyl
    mgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsech
    cavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfra
    ryfa