PDB entry 5uti

View 5uti on RCSB PDB site
Description: Crystal Structure of TGT in complex with fragment in preQ1 pocket
Class: transferase
Keywords: TGT, TRNA, Guanine exchange enzyme, transferase, preq1 pocket, guanine pocket
Deposited on 2017-02-15, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720
      • conflict (302)
    Domains in SCOPe 2.07: d5utia_
  • Heterogens: ZN, DMS, GGB, PGE, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5utiA (A:)
    drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
    ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshld
    gsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsr
    keqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvp
    mlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfse
    dlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegr
    fsqfaqdfraryfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5utiA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslstkqseegvtfkshldgsr
    hmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeq
    aenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlp
    ddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlk
    pldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsq
    faqdfraryfa