PDB entry 5utd

View 5utd on RCSB PDB site
Description: Sperm whale myoglobin V68A/I107Y with nitrite
Class: oxygen transport
Keywords: Heme, Myoglobin, Nitrite, Nitrosyl, Nitric oxide, Oxygen transport
Deposited on 2017-02-14, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185
      • engineered mutation (68)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d5utda_
  • Heterogens: HEM, SO4, NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5utdA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtaltalgailkkkghheaelkplaqshatkhkipikylefyseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5utdA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtaltalgailkkkghheaelkplaqshatkhkipikylefyseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgy