PDB entry 5utc

View 5utc on RCSB PDB site
Description: Deoxy form of sperm whale myoglobin V68A/I107Y
Class: oxygen transport
Keywords: Heme, Myoglobin, Nitrite, Nitrosyl, Nitric oxide, deoxy, OXYGEN TRANSPORT
Deposited on 2017-02-14, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185
      • engineered mutation (68)
      • engineered mutation (107)
      • variant (122)
    Domains in SCOPe 2.07: d5utca_
  • Heterogens: HEM, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5utcA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtaltalgailkkkghheaelkplaqshatkhkipikylefyseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5utcA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtaltalgailkkkghheaelkplaqshatkhkipikylefyseaiihvlhsrhp
    gnfgadaqgamnkalelfrkdiaakykelgyq