PDB entry 5ut7

View 5ut7 on RCSB PDB site
Description: Wild-type sperm whale myoglobin with nitrite
Class: oxygen transport
Keywords: Heme, Myoglobin, Nitrite, Nitrosyl, Nitric oxide, Hydrophilic orientation, OXYGEN TRANSPORT
Deposited on 2017-02-14, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • variant (122)
    Domains in SCOPe 2.07: d5ut7a_
  • Heterogens: HEM, NO2, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ut7A (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg