PDB entry 5usw

View 5usw on RCSB PDB site
Description: The crystal structure of 7,8-dihydropteroate synthase from Vibrio fischeri ES114
Class: transferase
Keywords: 7, 8-dihydropteroate synthase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2017-02-14, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Vibrio fischeri (strain ATCC 700601 / ES114) [TaxId:312309]
    Gene: folP, VF_0480
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E7M1 (3-280)
      • expression tag (2)
    Domains in SCOPe 2.07: d5uswa1, d5uswa2
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Vibrio fischeri (strain ATCC 700601 / ES114) [TaxId:312309]
    Gene: folP, VF_0480
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E7M1 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5uswb1, d5uswb2
  • Chain 'C':
    Compound: dihydropteroate synthase
    Species: Vibrio fischeri (strain ATCC 700601 / ES114) [TaxId:312309]
    Gene: folP, VF_0480
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E7M1 (3-280)
      • expression tag (2)
    Domains in SCOPe 2.07: d5uswc1, d5uswc2
  • Chain 'D':
    Compound: dihydropteroate synthase
    Species: Vibrio fischeri (strain ATCC 700601 / ES114) [TaxId:312309]
    Gene: folP, VF_0480
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E7M1 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5uswd1, d5uswd2
  • Heterogens: GOL, FMT, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uswA (A:)
    snamklisknksllldrshvmgilnvtpdsfsdggqfthldaalkqaekmvkagvsfidi
    ggestrpgapevslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindv
    ralqepnalkvaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgi
    akdklildpgfgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmals
    gslacatiaamkgaqiirvhdfeqtmdivkvcqatleqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uswA (A:)
    amklisknksllldrshvmgilnvtpdsfsdggqfthldaalkqaekmvkagvsfidigg
    estrpgapevslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindvra
    lqepnalkvaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgiak
    dklildpgfgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmalsgs
    lacatiaamkgaqiirvhdfeqtmdivkvcqatleqsph
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uswB (B:)
    snamklisknksllldrshvmgilnvtpdsfsdggqfthldaalkqaekmvkagvsfidi
    ggestrpgapevslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindv
    ralqepnalkvaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgi
    akdklildpgfgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmals
    gslacatiaamkgaqiirvhdfeqtmdivkvcqatleqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uswB (B:)
    amklisknksllldrshvmgilnvtpdthldaalkqaekmvkagvsfidiggestrpgap
    evslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindvralqepnalk
    vaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgiakdklildpg
    fgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmalsgslacatiaa
    mkgaqiirvhdfeqtmdivkvcqatleqsp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5uswC (C:)
    snamklisknksllldrshvmgilnvtpdsfsdggqfthldaalkqaekmvkagvsfidi
    ggestrpgapevslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindv
    ralqepnalkvaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgi
    akdklildpgfgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmals
    gslacatiaamkgaqiirvhdfeqtmdivkvcqatleqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uswC (C:)
    amklisknksllldrshvmgilnvtpdsfsdggqfthldaalkqaekmvkagvsfidigg
    estslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindvralqepnal
    kvaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgiakdklildp
    gfgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmalsgslacatia
    amkgaqiirvhdfeqtmdivkvcqatleqsph
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5uswD (D:)
    snamklisknksllldrshvmgilnvtpdsfsdggqfthldaalkqaekmvkagvsfidi
    ggestrpgapevslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindv
    ralqepnalkvaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgi
    akdklildpgfgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmals
    gslacatiaamkgaqiirvhdfeqtmdivkvcqatleqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uswD (D:)
    amklisknksllldrshvmgilnvtpfthldaalkqaekmvkagvsfidiggestrpgap
    evslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindvralqepnalk
    vaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgiakdklildpg
    fgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmalsgslacatiaa
    mkgaqiirvhdfeqtmdivkvcqatleqsp