PDB entry 5ush

View 5ush on RCSB PDB site
Description: Structure of vaccinia virus D8 protein bound to human Fab vv66
Class: VIRAL PROTEIN/Immune system
Keywords: viral protein, antibody, Fab, Immune response, Ig fold, VIRAL PROTEIN-Immune system complex
Deposited on 2017-02-13, released 2017-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IMV membrane protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: VAC_DPP17_124, VACAC2_124, VACCL3_124
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5usha_
  • Chain 'D':
    Compound: Fab vv66 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5USH (Start-223)
  • Chain 'E':
    Compound: Fab vv66 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5USH (Start-212)
    Domains in SCOPe 2.06: d5ushe1, d5ushe2
  • Chain 'H':
    Compound: Fab vv66 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5USH
  • Chain 'L':
    Compound: Fab vv66 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5USH (Start-212)
    Domains in SCOPe 2.06: d5ushl1, d5ushl2
  • Chain 'X':
    Compound: IMV membrane protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: VAC_DPP17_124, VACAC2_124, VACCL3_124
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1M1K6 (Start-233)
      • expression tag (234)
    Domains in SCOPe 2.06: d5ushx1, d5ushx2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ushA (A:)
    mpqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpne
    yvlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisif
    lqvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsada
    vwiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ushA (A:)
    qqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpneyv
    lsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisiflq
    vldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadavw
    iifptpinihsdqlskfrtllsyitenyrnpyklnddtevyys
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ushE (E:)
    qsaltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliygninrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsslsgalfgggtqltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvap
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ushE (E:)
    saltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliygninrpsgvp
    drfsgsksgtsaslaitglqaedeadyycqsydsslsgalfgggtqltvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ushL (L:)
    qsaltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliygninrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsslsgalfgggtqltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvap
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ushL (L:)
    saltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliygninrpsgvp
    drfsgsksgtsaslaitglqaedeadyycqsydsslsgalfgggtqltvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5ushX (X:)
    mpqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpne
    yvlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisif
    lqvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsada
    vwiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ushX (X:)
    pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
    vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
    qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
    wiifptpinihsdqlskfrtllslskphyitenyrnpyklnddtevyysg